Web stats for Chilliindia - chilliindia.com.au
1.67 Rating by ClearWebStats
This website has a #19,798,671 rank in global traffic. It has a .com.au as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, chilliindia.com.au is SAFE to browse.
Traffic Report of Chilliindia
Daily Unique Visitors: | 24 |
Daily Pageviews: | 48 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 19,798,671 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
36
Siteadvisor Rating
Not Applicable
Where is chilliindia.com.au server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 9 | H2 Headings: | 6 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 13 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 103.24.202.75)
.:: Kuchipudi dance classes in Dallas, Texas, Indian Classical dance classes in DFW, Abhinaya Kuchipudi Dance Academy ::.
- akdanceacademy.com
Indian Classical dance classes in DFW,Indian Classical dance classes in texas,Abhinaya Kuchipudi Dance Academy, Kalyani Avula, Kuchipudi, Kuchipudi Dance, Texas , Kuchipudi Dance, Frisco ,Kuchipudi Dance, Flower Mound, Kuchipudi Dance, Plano,Kuchipudi Dance, Irving,Indian Classical Dance, Texas,Indian Classical Dance, Frisco, Indian Classical Dance, Flower Mound, Indian Classical Dance, Plano, Indian Classical Dance, Irving, Indian Classical...
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 22 Dec 2016 08:24:28 GMT
Server: Apache
Last-Modified: Tue, 13 Sep 2016 10:31:51 GMT
Accept-Ranges: bytes
Content-Length: 30287
Content-Type: text/html
Status-Code: 200
Status: 200 OK
Date: Thu, 22 Dec 2016 08:24:28 GMT
Server: Apache
Last-Modified: Tue, 13 Sep 2016 10:31:51 GMT
Accept-Ranges: bytes
Content-Length: 30287
Content-Type: text/html
Domain Information for chilliindia.com.au
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
chilliindia.com.au | A | 14400 |
IP:103.24.202.75 |
chilliindia.com.au | NS | 14386 |
Target:ns1.outline.co.in |
chilliindia.com.au | NS | 14386 |
Target:ns2.outline.co.in |
chilliindia.com.au | SOA | 86400 |
MNAME:ns1.outline.co.in RNAME:techs.ibeesolutions.com Serial:2016061400 Refresh:86400 Retry:7200 Expire:3600000 |
chilliindia.com.au | MX | 14400 |
Priority:5 Target:ALT2.ASPMX.L.GOOGLE.COM |
chilliindia.com.au | MX | 14400 |
Priority:5 Target:ALT1.ASPMX.L.GOOGLE.COM |
chilliindia.com.au | MX | 14400 |
Priority:1 Target:ASPMX.L.GOOGLE.COM |
chilliindia.com.au | MX | 14400 |
Priority:10 Target:ALT4.ASPMX.L.GOOGLE.COM |
chilliindia.com.au | MX | 14400 |
Priority:10 Target:ALT3.ASPMX.L.GOOGLE.COM |
chilliindia.com.au | TXT | 14400 |
TXT:v=spf1 ip4:103.24.202.75 +a +mx +ip4:192.163.253.54 ~all |
Similarly Ranked Websites to Chilliindia
A Daily Dose of Holly
- adailydoseofholly.com
I’m Holly, a 22 year old Psychology graduate who talks a little too much, laughs a little too loud, eats more than the recommended, all whilst attending too many concerts. Join me on my blogging journey where you'll get to nosey in on my life and read about anything and everything.
Full WHOIS Lookup for chilliindia.com.au
BLACKLISTED: You have exceeded the query limit for your network or IP address and have been blacklisted.